Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for hantao 131. hantao Lv 1 1 pt. 9,785
  2. Avatar for roman madala 132. roman madala Lv 1 1 pt. 9,768
  3. Avatar for Sammy3c2b1a0 133. Sammy3c2b1a0 Lv 1 1 pt. 9,761
  4. Avatar for ArikLeer 134. ArikLeer Lv 1 1 pt. 9,755
  5. Avatar for rene1010 135. rene1010 Lv 1 1 pt. 9,740
  6. Avatar for fishercat 136. fishercat Lv 1 1 pt. 9,676
  7. Avatar for Sunmurder 137. Sunmurder Lv 1 1 pt. 9,647
  8. Avatar for booboonuu 138. booboonuu Lv 1 1 pt. 9,616
  9. Avatar for Auntecedent 139. Auntecedent Lv 1 1 pt. 9,597
  10. Avatar for Fartemis 140. Fartemis Lv 1 1 pt. 9,407

Comments