Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477
  1. Avatar for bcre8tvv 121. bcre8tvv Lv 1 1 pt. 9,335
  2. Avatar for Todd6485577 122. Todd6485577 Lv 1 1 pt. 9,328
  3. Avatar for Mohoernchen 123. Mohoernchen Lv 1 1 pt. 9,218
  4. Avatar for Jpilkington 124. Jpilkington Lv 1 1 pt. 9,109
  5. Avatar for pfirth 125. pfirth Lv 1 1 pt. 9,083
  6. Avatar for Capacocha 126. Capacocha Lv 1 1 pt. 9,038
  7. Avatar for xbp 127. xbp Lv 1 1 pt. 9,008
  8. Avatar for pruneau_44 128. pruneau_44 Lv 1 1 pt. 9,002
  9. Avatar for molleke 129. molleke Lv 1 1 pt. 8,955
  10. Avatar for AlkiP0Ps 130. AlkiP0Ps Lv 1 1 pt. 8,948

Comments