Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for bcre8tvv 121. bcre8tvv Lv 1 1 pt. 9,335
  2. Avatar for Todd6485577 122. Todd6485577 Lv 1 1 pt. 9,328
  3. Avatar for Mohoernchen 123. Mohoernchen Lv 1 1 pt. 9,218
  4. Avatar for Jpilkington 124. Jpilkington Lv 1 1 pt. 9,109
  5. Avatar for pfirth 125. pfirth Lv 1 1 pt. 9,083
  6. Avatar for Capacocha 126. Capacocha Lv 1 1 pt. 9,038
  7. Avatar for xbp 127. xbp Lv 1 1 pt. 9,008
  8. Avatar for pruneau_44 128. pruneau_44 Lv 1 1 pt. 9,002
  9. Avatar for molleke 129. molleke Lv 1 1 pt. 8,955
  10. Avatar for AlkiP0Ps 130. AlkiP0Ps Lv 1 1 pt. 8,948

Comments