Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477
  1. Avatar for Xartos 11. Xartos Lv 1 72 pts. 12,422
  2. Avatar for ucad 12. ucad Lv 1 70 pts. 12,421
  3. Avatar for Migi 13. Migi Lv 1 68 pts. 12,412
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 65 pts. 12,378
  5. Avatar for johnmitch 15. johnmitch Lv 1 63 pts. 12,359
  6. Avatar for robgee 16. robgee Lv 1 61 pts. 12,346
  7. Avatar for g_b 17. g_b Lv 1 59 pts. 12,345
  8. Avatar for mirp 18. mirp Lv 1 57 pts. 12,318
  9. Avatar for Formula350 19. Formula350 Lv 1 55 pts. 12,297
  10. Avatar for spmm 20. spmm Lv 1 53 pts. 12,270

Comments