Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for Xartos 11. Xartos Lv 1 72 pts. 12,422
  2. Avatar for ucad 12. ucad Lv 1 70 pts. 12,421
  3. Avatar for Migi 13. Migi Lv 1 68 pts. 12,412
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 65 pts. 12,378
  5. Avatar for johnmitch 15. johnmitch Lv 1 63 pts. 12,359
  6. Avatar for robgee 16. robgee Lv 1 61 pts. 12,346
  7. Avatar for g_b 17. g_b Lv 1 59 pts. 12,345
  8. Avatar for mirp 18. mirp Lv 1 57 pts. 12,318
  9. Avatar for Formula350 19. Formula350 Lv 1 55 pts. 12,297
  10. Avatar for spmm 20. spmm Lv 1 53 pts. 12,270

Comments