Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477
  1. Avatar for dcrwheeler 41. dcrwheeler Lv 1 23 pts. 11,602
  2. Avatar for georg137 42. georg137 Lv 1 23 pts. 11,539
  3. Avatar for ZeroLeak7 43. ZeroLeak7 Lv 1 22 pts. 11,502
  4. Avatar for Tygh 44. Tygh Lv 1 21 pts. 11,500
  5. Avatar for PieThrower 45. PieThrower Lv 1 20 pts. 11,336
  6. Avatar for KarenCH 46. KarenCH Lv 1 19 pts. 11,320
  7. Avatar for Lotus23 47. Lotus23 Lv 1 18 pts. 11,284
  8. Avatar for John McLeod 48. John McLeod Lv 1 17 pts. 11,256
  9. Avatar for pvc78 49. pvc78 Lv 1 17 pts. 11,242
  10. Avatar for heather-1 50. heather-1 Lv 1 16 pts. 11,201

Comments