Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for dcrwheeler 41. dcrwheeler Lv 1 23 pts. 11,602
  2. Avatar for georg137 42. georg137 Lv 1 23 pts. 11,539
  3. Avatar for ZeroLeak7 43. ZeroLeak7 Lv 1 22 pts. 11,502
  4. Avatar for Tygh 44. Tygh Lv 1 21 pts. 11,500
  5. Avatar for PieThrower 45. PieThrower Lv 1 20 pts. 11,336
  6. Avatar for KarenCH 46. KarenCH Lv 1 19 pts. 11,320
  7. Avatar for Lotus23 47. Lotus23 Lv 1 18 pts. 11,284
  8. Avatar for John McLeod 48. John McLeod Lv 1 17 pts. 11,256
  9. Avatar for pvc78 49. pvc78 Lv 1 17 pts. 11,242
  10. Avatar for heather-1 50. heather-1 Lv 1 16 pts. 11,201

Comments