Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477

  1. Avatar for MrZanav 61. MrZanav Lv 1 10 pts. 10,784
  2. Avatar for justjustin 62. justjustin Lv 1 9 pts. 10,730
  3. Avatar for phi16 64. phi16 Lv 1 8 pts. 10,625
  4. Avatar for SKSbell 65. SKSbell Lv 1 8 pts. 10,620
  5. Avatar for GuR0 66. GuR0 Lv 1 7 pts. 10,597
  6. Avatar for equilibria 67. equilibria Lv 1 7 pts. 10,584
  7. Avatar for borattt 68. borattt Lv 1 7 pts. 10,573
  8. Avatar for BarrySampson 69. BarrySampson Lv 1 6 pts. 10,535
  9. Avatar for fpc 70. fpc Lv 1 6 pts. 10,513

Comments