Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for MrZanav 61. MrZanav Lv 1 10 pts. 10,784
  2. Avatar for justjustin 62. justjustin Lv 1 9 pts. 10,730
  3. Avatar for CharlieFortsConscience 63. CharlieFortsConscience Lv 1 9 pts. 10,661
  4. Avatar for phi16 64. phi16 Lv 1 8 pts. 10,625
  5. Avatar for SKSbell 65. SKSbell Lv 1 8 pts. 10,620
  6. Avatar for GuR0 66. GuR0 Lv 1 7 pts. 10,597
  7. Avatar for equilibria 67. equilibria Lv 1 7 pts. 10,584
  8. Avatar for borattt 68. borattt Lv 1 7 pts. 10,573
  9. Avatar for BarrySampson 69. BarrySampson Lv 1 6 pts. 10,535
  10. Avatar for fpc 70. fpc Lv 1 6 pts. 10,513

Comments