Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for silent gene 11. silent gene Lv 1 70 pts. 10,919
  2. Avatar for Vinara 12. Vinara Lv 1 68 pts. 10,917
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 65 pts. 10,913
  4. Avatar for OWM3 14. OWM3 Lv 1 63 pts. 10,885
  5. Avatar for robgee 15. robgee Lv 1 60 pts. 10,877
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 58 pts. 10,865
  7. Avatar for Deleted player 17. Deleted player 56 pts. 10,828
  8. Avatar for PieThrower 18. PieThrower Lv 1 54 pts. 10,825
  9. Avatar for Phyx 19. Phyx Lv 1 52 pts. 10,823
  10. Avatar for ucad 20. ucad Lv 1 50 pts. 10,806

Comments