Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups


  1. Avatar for Go Science 100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262

  1. Avatar for silent gene 11. silent gene Lv 1 70 pts. 10,919
  2. Avatar for Vinara 12. Vinara Lv 1 68 pts. 10,917
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 65 pts. 10,913
  4. Avatar for OWM3 14. OWM3 Lv 1 63 pts. 10,885
  5. Avatar for robgee 15. robgee Lv 1 60 pts. 10,877
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 58 pts. 10,865
  7. Avatar for Deleted player 17. Deleted player 56 pts. 10,828
  8. Avatar for PieThrower 18. PieThrower Lv 1 54 pts. 10,825
  9. Avatar for Phyx 19. Phyx Lv 1 52 pts. 10,823
  10. Avatar for ucad 20. ucad Lv 1 50 pts. 10,806

Comments