Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 12 pts. 10,272
  2. Avatar for Hiro Protagonist 52. Hiro Protagonist Lv 1 12 pts. 10,262
  3. Avatar for Lotus23 53. Lotus23 Lv 1 11 pts. 10,247
  4. Avatar for pascal ochem 54. pascal ochem Lv 1 10 pts. 10,171
  5. Avatar for RockOn 55. RockOn Lv 1 10 pts. 10,165
  6. Avatar for John McLeod 56. John McLeod Lv 1 9 pts. 10,136
  7. Avatar for JasperD 57. JasperD Lv 1 9 pts. 10,097
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 8 pts. 10,065
  9. Avatar for anton_rsol96 59. anton_rsol96 Lv 1 8 pts. 10,055
  10. Avatar for heather-1 60. heather-1 Lv 1 7 pts. 10,050

Comments