Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 12 pts. 10,272
  2. Avatar for Hiro Protagonist 52. Hiro Protagonist Lv 1 12 pts. 10,262
  3. Avatar for Lotus23 53. Lotus23 Lv 1 11 pts. 10,247
  4. Avatar for pascal ochem 54. pascal ochem Lv 1 10 pts. 10,171
  5. Avatar for RockOn 55. RockOn Lv 1 10 pts. 10,165
  6. Avatar for John McLeod 56. John McLeod Lv 1 9 pts. 10,136
  7. Avatar for JasperD 57. JasperD Lv 1 9 pts. 10,097
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 8 pts. 10,065
  9. Avatar for anton_rsol96 59. anton_rsol96 Lv 1 8 pts. 10,055
  10. Avatar for heather-1 60. heather-1 Lv 1 7 pts. 10,050

Comments