Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542
  1. Avatar for fishercat 31. fishercat Lv 1 36 pts. 11,431
  2. Avatar for dpmattingly 32. dpmattingly Lv 1 35 pts. 11,419
  3. Avatar for pauldunn 33. pauldunn Lv 1 34 pts. 11,379
  4. Avatar for akaaka 34. akaaka Lv 1 32 pts. 11,372
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 31 pts. 11,371
  6. Avatar for ucad 36. ucad Lv 1 30 pts. 11,356
  7. Avatar for phi16 37. phi16 Lv 1 29 pts. 11,343
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 28 pts. 11,323
  9. Avatar for martinzblavy 39. martinzblavy Lv 1 27 pts. 11,317
  10. Avatar for Lotus23 40. Lotus23 Lv 1 25 pts. 11,305

Comments