Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542

  1. Avatar for NeLikomSheet 51. NeLikomSheet Lv 1 16 pts. 11,075
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 15 pts. 11,073
  3. Avatar for manu8170 53. manu8170 Lv 1 15 pts. 11,056
  4. Avatar for hansvandenhof 54. hansvandenhof Lv 1 14 pts. 11,032
  5. Avatar for Formula350 55. Formula350 Lv 1 13 pts. 11,006
  6. Avatar for vybi 56. vybi Lv 1 13 pts. 10,955
  7. Avatar for ShadowTactics 57. ShadowTactics Lv 1 12 pts. 10,909
  8. Avatar for donuts554 58. donuts554 Lv 1 12 pts. 10,897
  9. Avatar for MrZanav 59. MrZanav Lv 1 11 pts. 10,890
  10. Avatar for Tygh 60. Tygh Lv 1 11 pts. 10,880

Comments