Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542
  1. Avatar for tomespen 41. tomespen Lv 1 24 pts. 11,295
  2. Avatar for GuR0 42. GuR0 Lv 1 24 pts. 11,273
  3. Avatar for Mike Lewis 43. Mike Lewis Lv 1 23 pts. 11,256
  4. Avatar for KarenCH 44. KarenCH Lv 1 22 pts. 11,239
  5. Avatar for Pikkachurin 45. Pikkachurin Lv 1 21 pts. 11,214
  6. Avatar for TastyMunchies 46. TastyMunchies Lv 1 20 pts. 11,210
  7. Avatar for xythus 47. xythus Lv 1 19 pts. 11,192
  8. Avatar for heather-1 48. heather-1 Lv 1 18 pts. 11,175
  9. Avatar for maithra 49. maithra Lv 1 18 pts. 11,155
  10. Avatar for OWM3 50. OWM3 Lv 1 17 pts. 11,096

Comments