Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,030
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 12,009
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,976
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,974
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,927
  6. Avatar for Contenders 6. Contenders 16 pts. 11,926
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,831
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,785
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 10,973
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,776
  1. Avatar for rinze 101. rinze Lv 1 2 pts. 10,394
  2. Avatar for Beany 102. Beany Lv 1 2 pts. 10,389
  3. Avatar for MrZanav 103. MrZanav Lv 1 2 pts. 10,351
  4. Avatar for KNUbiothHans 104. KNUbiothHans Lv 1 2 pts. 10,347
  5. Avatar for tarimo 105. tarimo Lv 1 2 pts. 10,314
  6. Avatar for dahast.de 106. dahast.de Lv 1 1 pt. 10,307
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 1 pt. 10,294
  8. Avatar for Savas 108. Savas Lv 1 1 pt. 10,292
  9. Avatar for pr1stak 109. pr1stak Lv 1 1 pt. 10,283
  10. Avatar for RainBowFrog 110. RainBowFrog Lv 1 1 pt. 10,280

Comments