Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,030
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 12,009
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,976
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,974
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,927
  6. Avatar for Contenders 6. Contenders 16 pts. 11,926
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,831
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,785
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 10,973
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,776
  1. Avatar for chrishong995 141. chrishong995 Lv 1 1 pt. 9,989
  2. Avatar for Galve535 142. Galve535 Lv 1 1 pt. 9,983
  3. Avatar for dunkkedon 143. dunkkedon Lv 1 1 pt. 9,974
  4. Avatar for nekot 144. nekot Lv 1 1 pt. 9,961
  5. Avatar for swjeoung96 145. swjeoung96 Lv 1 1 pt. 9,942
  6. Avatar for sbk 146. sbk Lv 1 1 pt. 9,922
  7. Avatar for raibaa 147. raibaa Lv 1 1 pt. 9,921
  8. Avatar for fromeuil 148. fromeuil Lv 1 1 pt. 9,902
  9. Avatar for lega@unitybox.de 149. lega@unitybox.de Lv 1 1 pt. 9,872
  10. Avatar for joe1012 150. joe1012 Lv 1 1 pt. 9,718

Comments