Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 12,030
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 12,009
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,976
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,974
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,927
  6. Avatar for Contenders 6. Contenders 16 pts. 11,926
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,831
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,785
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 10,973
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,776

  1. Avatar for Lee Seung Hwan 131. Lee Seung Hwan Lv 1 1 pt. 10,104
  2. Avatar for ivalnic 132. ivalnic Lv 1 1 pt. 10,098
  3. Avatar for browk107 133. browk107 Lv 1 1 pt. 10,088
  4. Avatar for niamhev 134. niamhev Lv 1 1 pt. 10,087
  5. Avatar for froschi2 135. froschi2 Lv 1 1 pt. 10,076
  6. Avatar for InfoManiac742 136. InfoManiac742 Lv 1 1 pt. 10,045
  7. Avatar for Ivan Fredriksone 137. Ivan Fredriksone Lv 1 1 pt. 10,032
  8. Avatar for Stubb 138. Stubb Lv 1 1 pt. 10,032
  9. Avatar for GinGin 139. GinGin Lv 1 1 pt. 10,018
  10. Avatar for huiwon do 140. huiwon do Lv 1 1 pt. 10,003

Comments