Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for John McLeod 31. John McLeod Lv 1 37 pts. 11,245
  2. Avatar for pauldunn 32. pauldunn Lv 1 36 pts. 11,244
  3. Avatar for ProfVince 33. ProfVince Lv 1 35 pts. 11,236
  4. Avatar for Phyx 34. Phyx Lv 1 33 pts. 11,219
  5. Avatar for NeLikomSheet 35. NeLikomSheet Lv 1 32 pts. 11,206
  6. Avatar for fpc 36. fpc Lv 1 31 pts. 11,203
  7. Avatar for Joanna_H 37. Joanna_H Lv 1 30 pts. 11,180
  8. Avatar for BarrySampson 38. BarrySampson Lv 1 29 pts. 11,178
  9. Avatar for cjddig 39. cjddig Lv 1 28 pts. 11,162
  10. Avatar for fiendish_ghoul 40. fiendish_ghoul Lv 1 26 pts. 11,150

Comments