Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 17 pts. 11,053
  2. Avatar for Blipperman 52. Blipperman Lv 1 16 pts. 11,052
  3. Avatar for Trajan464 53. Trajan464 Lv 1 16 pts. 11,046
  4. Avatar for Pawel Tluscik 54. Pawel Tluscik Lv 1 15 pts. 11,031
  5. Avatar for Deleted player 55. Deleted player pts. 11,030
  6. Avatar for alcor29 56. alcor29 Lv 1 14 pts. 11,024
  7. Avatar for zackallen 57. zackallen Lv 1 13 pts. 10,986
  8. Avatar for heather-1 58. heather-1 Lv 1 13 pts. 10,976
  9. Avatar for MrZanav 59. MrZanav Lv 1 12 pts. 10,966
  10. Avatar for carsonfb 60. carsonfb Lv 1 11 pts. 10,959

Comments