Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for jsfoldingaccount 41. jsfoldingaccount Lv 1 25 pts. 11,141
  2. Avatar for drjr 42. drjr Lv 1 24 pts. 11,123
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 24 pts. 11,109
  4. Avatar for Kjambo 44. Kjambo Lv 1 23 pts. 11,105
  5. Avatar for Gerom 45. Gerom Lv 1 22 pts. 11,095
  6. Avatar for GuR0 46. GuR0 Lv 1 21 pts. 11,081
  7. Avatar for manu8170 47. manu8170 Lv 1 20 pts. 11,079
  8. Avatar for akaaka 48. akaaka Lv 1 19 pts. 11,066
  9. Avatar for swiesend 49. swiesend Lv 1 18 pts. 11,064
  10. Avatar for stomjoh 50. stomjoh Lv 1 18 pts. 11,060

Comments