Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for JasperD 91. JasperD Lv 1 1 pt. 10,269
  2. Avatar for JSon 92. JSon Lv 1 1 pt. 10,241
  3. Avatar for heyubob 93. heyubob Lv 1 1 pt. 10,236
  4. Avatar for saeb_19 94. saeb_19 Lv 1 1 pt. 10,231
  5. Avatar for ProfVince 95. ProfVince Lv 1 1 pt. 10,205
  6. Avatar for Kevonni 96. Kevonni Lv 1 1 pt. 10,200
  7. Avatar for Altercomp 97. Altercomp Lv 1 1 pt. 10,195
  8. Avatar for rabamino12358 98. rabamino12358 Lv 1 1 pt. 10,136
  9. Avatar for AlkiP0Ps 99. AlkiP0Ps Lv 1 1 pt. 10,133
  10. Avatar for pfirth 100. pfirth Lv 1 1 pt. 10,109

Comments