Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for JasperD 91. JasperD Lv 1 1 pt. 10,269
  2. Avatar for JSon 92. JSon Lv 1 1 pt. 10,241
  3. Avatar for heyubob 93. heyubob Lv 1 1 pt. 10,236
  4. Avatar for saeb_19 94. saeb_19 Lv 1 1 pt. 10,231
  5. Avatar for ProfVince 95. ProfVince Lv 1 1 pt. 10,205
  6. Avatar for Kevonni 96. Kevonni Lv 1 1 pt. 10,200
  7. Avatar for Altercomp 97. Altercomp Lv 1 1 pt. 10,195
  8. Avatar for rabamino12358 98. rabamino12358 Lv 1 1 pt. 10,136
  9. Avatar for AlkiP0Ps 99. AlkiP0Ps Lv 1 1 pt. 10,133
  10. Avatar for pfirth 100. pfirth Lv 1 1 pt. 10,109

Comments