Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for johnpwykes 111. johnpwykes Lv 1 1 pt. 9,983
  2. Avatar for monkry 112. monkry Lv 1 1 pt. 9,978
  3. Avatar for prooh 113. prooh Lv 1 1 pt. 9,969
  4. Avatar for jschroeter 114. jschroeter Lv 1 1 pt. 9,965
  5. Avatar for zo3xiaJonWeinberg 115. zo3xiaJonWeinberg Lv 1 1 pt. 9,941
  6. Avatar for MephistoMUC 116. MephistoMUC Lv 1 1 pt. 9,917
  7. Avatar for Hexacosichoron 117. Hexacosichoron Lv 1 1 pt. 9,916
  8. Avatar for Deleted player 118. Deleted player pts. 9,893
  9. Avatar for UMT 119. UMT Lv 1 1 pt. 9,871
  10. Avatar for skovz99 120. skovz99 Lv 1 1 pt. 9,831

Comments