Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for johnpwykes 111. johnpwykes Lv 1 1 pt. 9,983
  2. Avatar for monkry 112. monkry Lv 1 1 pt. 9,978
  3. Avatar for prooh 113. prooh Lv 1 1 pt. 9,969
  4. Avatar for jschroeter 114. jschroeter Lv 1 1 pt. 9,965
  5. Avatar for zo3xiaJonWeinberg 115. zo3xiaJonWeinberg Lv 1 1 pt. 9,941
  6. Avatar for MephistoMUC 116. MephistoMUC Lv 1 1 pt. 9,917
  7. Avatar for Hexacosichoron 117. Hexacosichoron Lv 1 1 pt. 9,916
  8. Avatar for Deleted player 118. Deleted player pts. 9,893
  9. Avatar for UMT 119. UMT Lv 1 1 pt. 9,871
  10. Avatar for skovz99 120. skovz99 Lv 1 1 pt. 9,831

Comments