Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for Top-SecreT 121. Top-SecreT Lv 1 1 pt. 9,786
  2. Avatar for nong9090 122. nong9090 Lv 1 1 pt. 9,785
  3. Avatar for diamonddays 123. diamonddays Lv 1 1 pt. 9,783
  4. Avatar for hen.wu.cs234 124. hen.wu.cs234 Lv 1 1 pt. 9,731
  5. Avatar for pascal ochem 125. pascal ochem Lv 1 1 pt. 9,704
  6. Avatar for mrsthursday1 126. mrsthursday1 Lv 1 1 pt. 9,702
  7. Avatar for LELE1964 127. LELE1964 Lv 1 1 pt. 9,656
  8. Avatar for m.a.g.e 128. m.a.g.e Lv 1 1 pt. 9,255
  9. Avatar for Simek 129. Simek Lv 1 1 pt. 9,130
  10. Avatar for BPS_RAIMONDI_2020 130. BPS_RAIMONDI_2020 Lv 1 1 pt. 8,801

Comments