Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for Top-SecreT 121. Top-SecreT Lv 1 1 pt. 9,786
  2. Avatar for nong9090 122. nong9090 Lv 1 1 pt. 9,785
  3. Avatar for diamonddays 123. diamonddays Lv 1 1 pt. 9,783
  4. Avatar for hen.wu.cs234 124. hen.wu.cs234 Lv 1 1 pt. 9,731
  5. Avatar for pascal ochem 125. pascal ochem Lv 1 1 pt. 9,704
  6. Avatar for mrsthursday1 126. mrsthursday1 Lv 1 1 pt. 9,702
  7. Avatar for LELE1964 127. LELE1964 Lv 1 1 pt. 9,656
  8. Avatar for m.a.g.e 128. m.a.g.e Lv 1 1 pt. 9,255
  9. Avatar for Simek 129. Simek Lv 1 1 pt. 9,130
  10. Avatar for BPS_RAIMONDI_2020 130. BPS_RAIMONDI_2020 Lv 1 1 pt. 8,801

Comments