Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for Fetztastic 11. Fetztastic Lv 1 69 pts. 11,225
  2. Avatar for silent gene 12. silent gene Lv 1 67 pts. 11,207
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 64 pts. 11,188
  4. Avatar for APPAAP 14. APPAAP Lv 1 62 pts. 11,171
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 59 pts. 11,158
  6. Avatar for sgeldhof 16. sgeldhof Lv 1 57 pts. 11,139
  7. Avatar for MicElephant 17. MicElephant Lv 1 55 pts. 11,133
  8. Avatar for OWM3 18. OWM3 Lv 1 53 pts. 11,126
  9. Avatar for g_b 19. g_b Lv 1 50 pts. 11,122
  10. Avatar for johnmitch 20. johnmitch Lv 1 48 pts. 11,112

Comments