Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for Fetztastic 11. Fetztastic Lv 1 69 pts. 11,225
  2. Avatar for silent gene 12. silent gene Lv 1 67 pts. 11,207
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 64 pts. 11,188
  4. Avatar for APPAAP 14. APPAAP Lv 1 62 pts. 11,171
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 59 pts. 11,158
  6. Avatar for sgeldhof 16. sgeldhof Lv 1 57 pts. 11,139
  7. Avatar for MicElephant 17. MicElephant Lv 1 55 pts. 11,133
  8. Avatar for OWM3 18. OWM3 Lv 1 53 pts. 11,126
  9. Avatar for g_b 19. g_b Lv 1 50 pts. 11,122
  10. Avatar for johnmitch 20. johnmitch Lv 1 48 pts. 11,112

Comments