Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for gdnskye 31. gdnskye Lv 1 30 pts. 11,013
  2. Avatar for Blipperman 32. Blipperman Lv 1 29 pts. 10,995
  3. Avatar for ZeroLeak7 33. ZeroLeak7 Lv 1 28 pts. 10,995
  4. Avatar for jobo0502 34. jobo0502 Lv 1 26 pts. 10,965
  5. Avatar for kyoota 35. kyoota Lv 1 25 pts. 10,941
  6. Avatar for fpc 36. fpc Lv 1 24 pts. 10,933
  7. Avatar for Anfinsen_slept_here 37. Anfinsen_slept_here Lv 1 23 pts. 10,927
  8. Avatar for robgee 38. robgee Lv 1 22 pts. 10,912
  9. Avatar for aznarog 39. aznarog Lv 1 21 pts. 10,911
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 20 pts. 10,883

Comments