Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for gdnskye 31. gdnskye Lv 1 30 pts. 11,013
  2. Avatar for Blipperman 32. Blipperman Lv 1 29 pts. 10,995
  3. Avatar for ZeroLeak7 33. ZeroLeak7 Lv 1 28 pts. 10,995
  4. Avatar for jobo0502 34. jobo0502 Lv 1 26 pts. 10,965
  5. Avatar for kyoota 35. kyoota Lv 1 25 pts. 10,941
  6. Avatar for fpc 36. fpc Lv 1 24 pts. 10,933
  7. Avatar for Anfinsen_slept_here 37. Anfinsen_slept_here Lv 1 23 pts. 10,927
  8. Avatar for robgee 38. robgee Lv 1 22 pts. 10,912
  9. Avatar for aznarog 39. aznarog Lv 1 21 pts. 10,911
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 20 pts. 10,883

Comments