Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for John McLeod 51. John McLeod Lv 1 11 pts. 10,748
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 11 pts. 10,719
  3. Avatar for manu8170 53. manu8170 Lv 1 10 pts. 10,712
  4. Avatar for fishercat 54. fishercat Lv 1 10 pts. 10,679
  5. Avatar for xythus 55. xythus Lv 1 9 pts. 10,650
  6. Avatar for equilibria 56. equilibria Lv 1 9 pts. 10,650
  7. Avatar for NeedMoreCoffee 57. NeedMoreCoffee Lv 1 8 pts. 10,642
  8. Avatar for REDing 58. REDing Lv 1 8 pts. 10,629
  9. Avatar for BarrySampson 59. BarrySampson Lv 1 7 pts. 10,626
  10. Avatar for katling 60. katling Lv 1 7 pts. 10,618

Comments