Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600

  1. Avatar for John McLeod 51. John McLeod Lv 1 11 pts. 10,748
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 11 pts. 10,719
  3. Avatar for manu8170 53. manu8170 Lv 1 10 pts. 10,712
  4. Avatar for fishercat 54. fishercat Lv 1 10 pts. 10,679
  5. Avatar for xythus 55. xythus Lv 1 9 pts. 10,650
  6. Avatar for equilibria 56. equilibria Lv 1 9 pts. 10,650
  7. Avatar for NeedMoreCoffee 57. NeedMoreCoffee Lv 1 8 pts. 10,642
  8. Avatar for REDing 58. REDing Lv 1 8 pts. 10,629
  9. Avatar for BarrySampson 59. BarrySampson Lv 1 7 pts. 10,626
  10. Avatar for katling 60. katling Lv 1 7 pts. 10,618

Comments