Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for Dhalion 111. Dhalion Lv 1 1 pt. 8,215
  2. Avatar for borattt 112. borattt Lv 1 1 pt. 8,198
  3. Avatar for CAN1958 113. CAN1958 Lv 1 1 pt. 8,123
  4. Avatar for ProfVince 114. ProfVince Lv 1 1 pt. 8,088
  5. Avatar for phi16 115. phi16 Lv 1 1 pt. 8,000
  6. Avatar for Agustinesp3 116. Agustinesp3 Lv 1 1 pt. 7,848
  7. Avatar for alwen 117. alwen Lv 1 1 pt. 7,712
  8. Avatar for mollyfoldit 118. mollyfoldit Lv 1 1 pt. 7,703
  9. Avatar for Yann1ck2000 119. Yann1ck2000 Lv 1 1 pt. 7,655
  10. Avatar for Kajmarez 120. Kajmarez Lv 1 1 pt. 7,628

Comments