Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for heather-1 51. heather-1 Lv 1 13 pts. 9,775
  2. Avatar for blazegeek 52. blazegeek Lv 1 12 pts. 9,760
  3. Avatar for alcor29 53. alcor29 Lv 1 12 pts. 9,758
  4. Avatar for fpc 54. fpc Lv 1 11 pts. 9,700
  5. Avatar for antibot215 55. antibot215 Lv 1 11 pts. 9,662
  6. Avatar for Deleted player 56. Deleted player pts. 9,655
  7. Avatar for Simek 57. Simek Lv 1 10 pts. 9,644
  8. Avatar for REDing 58. REDing Lv 1 9 pts. 9,630
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 9 pts. 9,621
  10. Avatar for NeedMoreCoffee 60. NeedMoreCoffee Lv 1 8 pts. 9,593

Comments