Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for Primrose 121. Primrose Lv 1 1 pt. 8,549
  2. Avatar for DScott 122. DScott Lv 1 1 pt. 8,547
  3. Avatar for evelpinkybrain 123. evelpinkybrain Lv 1 1 pt. 8,510
  4. Avatar for little scientist 124. little scientist Lv 1 1 pt. 8,496
  5. Avatar for helcboom 125. helcboom Lv 1 1 pt. 8,490
  6. Avatar for artsyambie6 126. artsyambie6 Lv 1 1 pt. 8,483
  7. Avatar for Swapper242 127. Swapper242 Lv 1 1 pt. 8,482
  8. Avatar for illex 128. illex Lv 1 1 pt. 8,482
  9. Avatar for rejuvenatio 129. rejuvenatio Lv 1 1 pt. 8,374
  10. Avatar for deathbat_87 130. deathbat_87 Lv 1 1 pt. 8,371

Comments