Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for Fields 131. Fields Lv 1 1 pt. 8,281
  2. Avatar for ssrinivasan1 132. ssrinivasan1 Lv 1 1 pt. 8,025
  3. Avatar for KylarRen 133. KylarRen Lv 1 1 pt. 7,987
  4. Avatar for zannipietro 134. zannipietro Lv 1 1 pt. 7,976
  5. Avatar for krg0029 135. krg0029 Lv 1 1 pt. 7,911
  6. Avatar for harvardman 136. harvardman Lv 1 1 pt. 7,855
  7. Avatar for jflat06 137. jflat06 Lv 1 1 pt. 7,774
  8. Avatar for SuperSallyGUO 138. SuperSallyGUO Lv 1 1 pt. 7,721
  9. Avatar for 2339140839 139. 2339140839 Lv 1 1 pt. 6,739
  10. Avatar for jasmeeng1 140. jasmeeng1 Lv 1 1 pt. 3,473

Comments