Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for milkshake 141. milkshake Lv 1 1 pt. 2,942
  2. Avatar for devjosh 142. devjosh Lv 1 1 pt. 2,942
  3. Avatar for nze0017 143. nze0017 Lv 1 1 pt. 2,942
  4. Avatar for Vincera 144. Vincera Lv 1 1 pt. 2,942
  5. Avatar for tmaloney2 145. tmaloney2 Lv 1 1 pt. 2,942
  6. Avatar for Keresto 146. Keresto Lv 1 1 pt. 2,942
  7. Avatar for daria.p 147. daria.p Lv 1 1 pt. 2,942
  8. Avatar for Paulina17916 148. Paulina17916 Lv 1 1 pt. 2,942
  9. Avatar for johnpwykes 149. johnpwykes Lv 1 1 pt. 2,942

Comments