Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for SileNTViP 11. SileNTViP Lv 1 71 pts. 10,059
  2. Avatar for PieThrower 12. PieThrower Lv 1 68 pts. 10,053
  3. Avatar for Aubade01 13. Aubade01 Lv 1 66 pts. 10,047
  4. Avatar for nicobul 14. nicobul Lv 1 64 pts. 10,016
  5. Avatar for LociOiling 15. LociOiling Lv 1 61 pts. 10,010
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 59 pts. 10,008
  7. Avatar for silent gene 17. silent gene Lv 1 57 pts. 10,001
  8. Avatar for Norrjane 18. Norrjane Lv 1 55 pts. 9,999
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 53 pts. 9,993
  10. Avatar for MicElephant 20. MicElephant Lv 1 51 pts. 9,963

Comments