Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for jobo0502 21. jobo0502 Lv 1 49 pts. 9,962
  2. Avatar for guineapig 22. guineapig Lv 1 47 pts. 9,958
  3. Avatar for frood66 23. frood66 Lv 1 45 pts. 9,955
  4. Avatar for pauldunn 24. pauldunn Lv 1 43 pts. 9,951
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 42 pts. 9,940
  6. Avatar for borattt 26. borattt Lv 1 40 pts. 9,906
  7. Avatar for Blipperman 27. Blipperman Lv 1 39 pts. 9,888
  8. Avatar for NeLikomSheet 28. NeLikomSheet Lv 1 37 pts. 9,879
  9. Avatar for aznarog 29. aznarog Lv 1 36 pts. 9,866
  10. Avatar for Lotus23 30. Lotus23 Lv 1 34 pts. 9,864

Comments