Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for jobo0502 21. jobo0502 Lv 1 49 pts. 9,962
  2. Avatar for guineapig 22. guineapig Lv 1 47 pts. 9,958
  3. Avatar for frood66 23. frood66 Lv 1 45 pts. 9,955
  4. Avatar for pauldunn 24. pauldunn Lv 1 43 pts. 9,951
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 42 pts. 9,940
  6. Avatar for borattt 26. borattt Lv 1 40 pts. 9,906
  7. Avatar for Blipperman 27. Blipperman Lv 1 39 pts. 9,888
  8. Avatar for NeLikomSheet 28. NeLikomSheet Lv 1 37 pts. 9,879
  9. Avatar for aznarog 29. aznarog Lv 1 36 pts. 9,866
  10. Avatar for Lotus23 30. Lotus23 Lv 1 34 pts. 9,864

Comments