Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for DJDani 141. DJDani Lv 1 1 pt. 9,188
  2. Avatar for Mudrock 142. Mudrock Lv 1 1 pt. 9,109
  3. Avatar for Aarrn33 143. Aarrn33 Lv 1 1 pt. 9,071
  4. Avatar for kurze 144. kurze Lv 1 1 pt. 8,978
  5. Avatar for moonlight2020 145. moonlight2020 Lv 1 1 pt. 8,969
  6. Avatar for alyssa_d_V2.0 146. alyssa_d_V2.0 Lv 1 1 pt. 8,611
  7. Avatar for RockOn 147. RockOn Lv 1 1 pt. 7,484
  8. Avatar for wdmemcle 148. wdmemcle Lv 1 1 pt. 6,636
  9. Avatar for Kombinerki PX 23 149. Kombinerki PX 23 Lv 1 1 pt. 5,355
  10. Avatar for CharlieFortsConscience 150. CharlieFortsConscience Lv 1 1 pt. 5,352

Comments