Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903
  1. Avatar for DJDani 141. DJDani Lv 1 1 pt. 9,188
  2. Avatar for Mudrock 142. Mudrock Lv 1 1 pt. 9,109
  3. Avatar for Aarrn33 143. Aarrn33 Lv 1 1 pt. 9,071
  4. Avatar for kurze 144. kurze Lv 1 1 pt. 8,978
  5. Avatar for moonlight2020 145. moonlight2020 Lv 1 1 pt. 8,969
  6. Avatar for alyssa_d_V2.0 146. alyssa_d_V2.0 Lv 1 1 pt. 8,611
  7. Avatar for RockOn 147. RockOn Lv 1 1 pt. 7,484
  8. Avatar for wdmemcle 148. wdmemcle Lv 1 1 pt. 6,636
  9. Avatar for Kombinerki PX 23 149. Kombinerki PX 23 Lv 1 1 pt. 5,355
  10. Avatar for CharlieFortsConscience 150. CharlieFortsConscience Lv 1 1 pt. 5,352

Comments