Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for silent gene 11. silent gene Lv 1 72 pts. 11,547
  2. Avatar for Phyx 12. Phyx Lv 1 70 pts. 11,546
  3. Avatar for guineapig 13. guineapig Lv 1 67 pts. 11,545
  4. Avatar for PigeonBar 14. PigeonBar Lv 1 65 pts. 11,528
  5. Avatar for georg137 15. georg137 Lv 1 63 pts. 11,522
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 60 pts. 11,507
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 58 pts. 11,503
  8. Avatar for equilibria 18. equilibria Lv 1 56 pts. 11,498
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 54 pts. 11,490
  10. Avatar for MicElephant 20. MicElephant Lv 1 52 pts. 11,487

Comments