Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903
  1. Avatar for Hustvedt 131. Hustvedt Lv 1 1 pt. 9,701
  2. Avatar for Sammy3c2b1a0 132. Sammy3c2b1a0 Lv 1 1 pt. 9,676
  3. Avatar for Swapper242 133. Swapper242 Lv 1 1 pt. 9,666
  4. Avatar for G-Action 134. G-Action Lv 1 1 pt. 9,613
  5. Avatar for Guillaume628 135. Guillaume628 Lv 1 1 pt. 9,605
  6. Avatar for PhGa 136. PhGa Lv 1 1 pt. 9,537
  7. Avatar for tracy702 137. tracy702 Lv 1 1 pt. 9,533
  8. Avatar for Nipp Susanne 138. Nipp Susanne Lv 1 1 pt. 9,489
  9. Avatar for Katarzyna1234 139. Katarzyna1234 Lv 1 1 pt. 9,484
  10. Avatar for mallco 140. mallco Lv 1 1 pt. 9,469

Comments