Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278

  1. Avatar for phi16 11. phi16 Lv 1 75 pts. 10,965
  2. Avatar for Phyx 12. Phyx Lv 1 73 pts. 10,960
  3. Avatar for NeLikomSheet 13. NeLikomSheet Lv 1 71 pts. 10,953
  4. Avatar for mirp 14. mirp Lv 1 68 pts. 10,952
  5. Avatar for Anfinsen_slept_here 15. Anfinsen_slept_here Lv 1 66 pts. 10,928
  6. Avatar for Todd6485577 16. Todd6485577 Lv 1 64 pts. 10,928
  7. Avatar for Deleted player 17. Deleted player 62 pts. 10,921
  8. Avatar for robgee 18. robgee Lv 1 60 pts. 10,912
  9. Avatar for silent gene 19. silent gene Lv 1 59 pts. 10,895
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 57 pts. 10,891

Comments