Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278
  1. Avatar for Galaxie 31. Galaxie Lv 1 40 pts. 10,756
  2. Avatar for AmaralMo 32. AmaralMo Lv 1 38 pts. 10,755
  3. Avatar for georg137 33. georg137 Lv 1 37 pts. 10,752
  4. Avatar for ucad 34. ucad Lv 1 36 pts. 10,743
  5. Avatar for BootsMcGraw 35. BootsMcGraw Lv 1 34 pts. 10,738
  6. Avatar for vybi 36. vybi Lv 1 33 pts. 10,701
  7. Avatar for equilibria 37. equilibria Lv 1 32 pts. 10,685
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 31 pts. 10,653
  9. Avatar for infjamc 39. infjamc Lv 1 30 pts. 10,634
  10. Avatar for borattt 40. borattt Lv 1 29 pts. 10,525

Comments