Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278

  1. Avatar for jobo0502 21. jobo0502 Lv 1 55 pts. 10,882
  2. Avatar for guineapig 22. guineapig Lv 1 53 pts. 10,846
  3. Avatar for MicElephant 23. MicElephant Lv 1 52 pts. 10,841
  4. Avatar for aznarog 24. aznarog Lv 1 50 pts. 10,837
  5. Avatar for g_b 25. g_b Lv 1 48 pts. 10,830
  6. Avatar for Norrjane 26. Norrjane Lv 1 47 pts. 10,823
  7. Avatar for ProfVince 27. ProfVince Lv 1 45 pts. 10,778
  8. Avatar for dcrwheeler 28. dcrwheeler Lv 1 44 pts. 10,771
  9. Avatar for Pazithi 29. Pazithi Lv 1 42 pts. 10,767
  10. Avatar for PigeonBar 30. PigeonBar Lv 1 41 pts. 10,761

Comments