1993: Revisiting Puzzle 64: Thioredoxin
Closed since almost 5 years ago
Novice Overall PredictionSummary
- Created
- May 13, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
