Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,805
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,794
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,783
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,692
  6. Avatar for Contenders 6. Contenders 18 pts. 11,626
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,602
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 11,536
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 11,442
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 11,400
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 51 pts. 11,611
  2. Avatar for Pazithi 22. Pazithi Lv 1 50 pts. 11,602
  3. Avatar for toshiue 23. toshiue Lv 1 48 pts. 11,601
  4. Avatar for Deleted player 24. Deleted player 46 pts. 11,589
  5. Avatar for Lotus23 25. Lotus23 Lv 1 44 pts. 11,583
  6. Avatar for silent gene 26. silent gene Lv 1 43 pts. 11,582
  7. Avatar for akaaka 27. akaaka Lv 1 41 pts. 11,572
  8. Avatar for phi16 28. phi16 Lv 1 40 pts. 11,571
  9. Avatar for Todd6485577 29. Todd6485577 Lv 1 38 pts. 11,553
  10. Avatar for ucad 30. ucad Lv 1 37 pts. 11,552

Comments